HORDB

ID: hor001001
Uniprot ID: P01350
Protein name: Big gastrin
Gene name: GAST
Organism: Homo sapiens (Human)
Family: Gastrin/cholecystokinin family
Source: Human
Expression: NA
Disease: Diseases associated with GAST include Gastritis and Zollinger-Ellison Syndrome.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005515 protein binding
GO BP: GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence: QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
Length: 34
Propeptide: MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
Signal peptide: MQRLCVYVLIFALALAAFSEA
Modification: T1 Pyrrolidone carboxylic acid;T18 Pyrrolidone carboxylic acid;T29 Sulfotyrosine;T34 Phenylalanine amide
Glycosylation: NA
Mutagenesis: 28-28A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 versus gastrin-34 production; 29-29A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 v

Function: Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine.
Mechanism: NA
Cross BBB: NA
Target: CCKBR
Target Unid: P32239
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor001001_AF2.pdb

hor001001_ESM.pdb

Mass:	445606	Formula:	C176H253N43O54S
Absent amino acids:	CINRT	Common amino acids:	EP
pI:	3.99	Basic residues:	3
Polar residues:	6	Hydrophobic residues:	9
Hydrophobicity:	-104.71	Boman Index:	-5124
Half-Life:	0.8 hour	Half-Life Yeast:	10 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	48.82
Instability Index:	7818.24	Extinction Coefficient cystines:	12490
Absorbance 280nm:	378.48