General Information

  • ID:  hor001001
  • Uniprot ID:  P01350
  • Protein name:  Big gastrin
  • Gene name:  GAST
  • Organism:  Homo sapiens (Human)
  • Family:  Gastrin/cholecystokinin family
  • Source:  Human
  • Expression:  NA
  • Disease:  Diseases associated with GAST include Gastritis and Zollinger-Ellison Syndrome.
  • Comments:  NA
  • Taxonomy:  Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005515 protein binding
  • GO BP:  GO:0007165 signal transduction; GO:0007186 G protein-coupled receptor signaling pathway; GO:0032094 response to food
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDF
  • Length:  34(59-92)
  • Propeptide:  MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQLGPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
  • Signal peptide:  MQRLCVYVLIFALALAAFSEA
  • Modification:  T1 Pyrrolidone carboxylic acid;T18 Pyrrolidone carboxylic acid;T29 Sulfotyrosine;T34 Phenylalanine amide
  • Glycosylation:  NA
  • Mutagenesis:  28-28A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 versus gastrin-34 production; 29-29A->D: Small increase in ratio of gastrin-17 versus gastrin-34 production. No change in ratio of gastrin-17 v

Activity

  • Function:  Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  CCKBR
  • Target Unid:   P32239
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P01350-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001001_AF2.pdbhor001001_ESM.pdb

Physical Information

Mass: 445606 Formula: C176H253N43O54S
Absent amino acids: CINRT Common amino acids: EP
pI: 3.99 Basic residues: 3
Polar residues: 6 Hydrophobic residues: 9
Hydrophobicity: -104.71 Boman Index: -5124
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 48.82
Instability Index: 7818.24 Extinction Coefficient cystines: 12490
Absorbance 280nm: 378.48

Literature

  • PubMed ID:  NA
  • Title:  NA